KCNK5 Rabbit Polyclonal Antibody TA338537 from OriGene Technologies | Biocompare.com

Supplier Images

KCNK5 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNK5 Rabbit Polyclonal Antibody

OriGene Technologies' KCNK5 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The KCNK5 Rabbit Polyclonal Antibody was generated using KCNK5 as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-Kcnk5 Antibody

Product Specs
ItemKCNK5 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA338537
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityMouse
TargetKcnk5
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Kcnk5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTAS
NCBI Full Gene Namepotassium two pore domain channel subfamily K member 5
NCBI Gene AliasesKCNK5b, TASK2, K2p5.1, TASK-2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!